PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0432s0150.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family TALE
Protein Properties Length: 650aa    MW: 71427.1 Da    PI: 6.3312
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0432s0150.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.33e-093904271954
                             HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                             Fe   ++yp+ +++  LA+++gLt +qV++WF N R +
  SapurV1A.0432s0150.2.p 390 FEHflHPYPKDSDKIMLARQTGLTRSQVSNWFINARVR 427
                             554459******************************88 PP

2BELL127.74e-41252323172
                    BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                             erqelq+k +kLls+l+eVd+r+kqy++q+q+v+ssF+++ g+gsakpYt+lAl++iSrhFrcL+dai++qi
  SapurV1A.0432s0150.2.p 252 ERQELQNKLTKLLSMLDEVDRRFKQYYHQMQIVVSSFDVISGCGSAKPYTALALQTISRHFRCLRDAITGQI 323
                             79*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.4E-64176321IPR006563POX domain
PfamPF075263.7E-51182320IPR006563POX domain
PROSITE profilePS5007112.195368431IPR001356Homeobox domain
CDDcd000867.08E-13371432No hitNo description
SMARTSM003898.3E-10371435IPR001356Homeobox domain
SuperFamilySSF466893.72E-17372438IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.0E-28374437IPR009057Homeodomain-like
PfamPF059204.4E-18388427IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 650 aa     Download sequence    Send to blast
MATYYTSSNN QRDGAAMVYL PGSYPDAPVL PGSMMMYMNS GSYPDNLAGN SHQQNNCIEF  60
QSVENSDSTP QQQEILSNLG GSRIGEHDFG AWRDGRNEML VVHSVNGVSS VLNGAQSLQG  120
QGLSLSLGTQ IQSGIQMPSI SYRNTNSGLT SFLSPNSSFT GNHDVNKGDL SPYGMNSIAR  180
TIPNSKYLKV AQQLLDEVVN VRRALNQPDK EKNQTTSEHG LNSAKDGDSE SKNGASNLQE  240
STNPPSELSH AERQELQNKL TKLLSMLDEV DRRFKQYYHQ MQIVVSSFDV ISGCGSAKPY  300
TALALQTISR HFRCLRDAIT GQIHATRKSL GEQEASENLK GVGITRLRYV DQHLRHQRAL  360
HQLGMMQQHA WRPQRGLPES SVSVLRAWLF EHFLHPYPKD SDKIMLARQT GLTRSQVSNW  420
FINARVRLWK PMVEEMYKEE LGDAEMDSNS SSENAAKETK GDMGTSEDRV EEFQQSASST  480
ATERCTAGQL MDPKSDHVPD MKMAGSTTRS NFQNGTRGEA FTEYGLLKLR EDQRPSMDDC  540
SLFSDAMVHS EGGGDRFIAA AAAAYQMSEV GRFGNGSGVS LTLGLQHCEG GNLPMSGTTH  600
HGFVSMRGDD DIYNAASSVG AGATDFECLN PGNRQHRFSS SHVFHDFVA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A1e-16377434158Homeobox protein Meis1
4xrs_B1e-16377434158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT0288611e-174CT028861.1 Poplar cDNA sequences.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011037163.10.0PREDICTED: BEL1-like homeodomain protein 6
TrEMBLB9H0U80.0B9H0U8_POPTR; Uncharacterized protein
STRINGPOPTR_0004s16660.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16400.11e-144BEL1-like homeodomain 7